HPA015603

antibody from Atlas Antibodies

Targeting: NSRP1 CCDC55, DKFZP434K1421, NSrp70

Antibody data

Submit

Validation data

Product number: HPA015603 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA015603, RRID:AB_1846157
Product name: Anti-NSRP1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GEFDDKEAFVTSAYKKKLQERAEEEEREKRAAALE ACLDVTKQKDLSGFYRHLLNQAVGEEEVPKCSFRE ARSGIKEEKSRGFSNEVSSKNRIPQEKCILQTDVK VEENPDADSDFDAKSSADDEIEETRVNCRREK
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

NSRP1 protein structure - HPA015603 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, lymph node and testis using Anti-NSRP1 antibody HPA015603 (A) shows similar protein distribution across tissues to independent antibody HPA015593 (B).
Antibody #2 product nr: HPA015593
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows nuclear positivity of cells in seminiferus ducts.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-NSRP1 antibody HPA015603.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-NSRP1 antibody HPA015603.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-NSRP1 antibody HPA015603.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-NSRP1 antibody HPA015603.
Sample type: HUMAN