Antibody data

Product number
H00094039-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00094039-M01, RRID:AB_1582049
Product name
ZNF101 monoclonal antibody (M01), clone 2D5
Provider product page
Abnova Corporation - H00094039-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ZNF101.
Antigen sequence
LRHSFLDRHMRAHAGHKRSECGGEWRETPRKQKQH
GKASISPSSGARRTVTPTRKRPYECKVCGKAFNSP
NLFQIHQRTHTGKRSYKCRE
Isotype
IgG
Antibody clone number
2D5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -