Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00026229-B01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00026229-B01P, RRID:AB_1237736
- Product name
- B3GAT3 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human B3GAT3 protein.
- Antigen sequence
MKLKLKNVFLAYFLVSIAGLLYALVQLGQPCDCLP
PLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPE
PEALPTIYVVTPTYARLVQKAELVRLSQTLSLVPR
LHWLLVEDAEGPTPLVSGLLAASGLLFTHLVVLTP
KAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGAV
GGEKDPPPPGTQGVVYFADDDNTYSRELFEEMRWT
RGVSVWPVGLVGGLRFEGPQVQDGRVVGFHTAWEP
SRPFPVDMAGFAVALPLLLDKPNAQFDSTAPRGHL
ESSLLSHLVDPKDLEPRAANCTRVLVWHTRTEKPK
MKQEEQLQRQGRGSDPAIEV- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Skeletal dysplasia in a consanguineous clan from the island of Nias/Indonesia is caused by a novel mutation in B3GAT3.
Faulty initiation of proteoglycan synthesis causes cardiac and joint defects.
Activation of TonEBP by calcium controls {beta}1,3-glucuronosyltransferase-I expression, a key regulator of glycosaminoglycan synthesis in cells of the intervertebral disc.
Budde BS, Mizumoto S, Kogawa R, Becker C, Altmüller J, Thiele H, Rüschendorf F, Toliat MR, Kaleschke G, Hämmerle JM, Höhne W, Sugahara K, Nürnberg P, Kennerknecht I
Human genetics 2015 Jul;134(7):691-704
Human genetics 2015 Jul;134(7):691-704
Faulty initiation of proteoglycan synthesis causes cardiac and joint defects.
Baasanjav S, Al-Gazali L, Hashiguchi T, Mizumoto S, Fischer B, Horn D, Seelow D, Ali BR, Aziz SA, Langer R, Saleh AA, Becker C, Nürnberg G, Cantagrel V, Gleeson JG, Gomez D, Michel JB, Stricker S, Lindner TH, Nürnberg P, Sugahara K, Mundlos S, Hoffmann K
American journal of human genetics 2011 Jul 15;89(1):15-27
American journal of human genetics 2011 Jul 15;89(1):15-27
Activation of TonEBP by calcium controls {beta}1,3-glucuronosyltransferase-I expression, a key regulator of glycosaminoglycan synthesis in cells of the intervertebral disc.
Hiyama A, Gajghate S, Sakai D, Mochida J, Shapiro IM, Risbud MV
The Journal of biological chemistry 2009 Apr 10;284(15):9824-34
The Journal of biological chemistry 2009 Apr 10;284(15):9824-34
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of B3GAT3 expression in transfected 293T cell line (H00026229-T01) by B3GAT3 MaxPab polyclonal antibody.Lane 1: B3GAT3 transfected lysate(36.85 KDa).Lane 2: Non-transfected lysate.