HPA021046

UBR4 antibody from Sigma-Aldrich
KIAA0462, KIAA1307, RBAF600, ZUBR1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021046
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021046, RRID:AB_1858578
Product name
Anti-UBR4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021046
Antibody type
Polyclonal
Antigen
E3 ubiquitin-protein ligase UBR4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VEFGGNDLLQVYNAQQIKHRLNSTGMYVANTKPGG
FTIEISNNNSTMVMTGMRIQIGTQAIERAPSYIEI
FGRTMQLNLSRSRWFDFPFTREEALQADKKLNLFI
GASVDPAGVTMIDAVKIYGKTKEQF
Storage
-20C
Provider Type Product Number
- No reagents -