Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003092-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003092-M01, RRID:AB_464396
- Product name
- HIP1 monoclonal antibody (M01), clone 1F12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HIP1.
- Antigen sequence
DSPNLAQLQQASRGVNQATAGVVASTISGKSQIEE
TDNMDFSSMTLTQIKRQEMDSQVRVLELENELQKE
RQKLGELRKKHYELAGVAEGWEEGTEASPPTLQEV
VTEKE- Isotype
- IgG
- Antibody clone number
- 1F12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HIP1 monoclonal antibody (M01), clone 1F12 Western Blot analysis of HIP1 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of HIP1 expression in transfected 293T cell line by HIP1 monoclonal antibody (M01), clone 1F12.Lane 1: HIP1 transfected lysate(116.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HIP1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of HIP1 transfected lysate using anti-HIP1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with HIP1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to HIP1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol