HPA013606

HIP1 antibody from Sigma-Aldrich
ILWEQ
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013606
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013606, RRID:AB_1850717
Product name
Anti-HIP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013606
Antibody type
Polyclonal
Antigen
Huntingtin-interacting protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NFLRASALSEHISPVVVIPAEASSPDSEPVLEKDD
LMDMDASQQNLFDNKFDDIFGSSFSSDPFNFNSQN
GVNKDEKDHLIERLYREISGLKAQLENMKTESQRV
VLQLKGHVSELEADLAEQQHLRQQAADDCEFLRAE
LDELRRQRED
Storage
-20C
Provider Type Product Number
- No reagents -