HPA017964

HIP1 antibody from MilliporeSigma / Merck KGaA
ILWEQ
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017964
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA017964, RRID:AB_1850719
Product name
Anti-HIP1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA017964
Antibody type
Polyclonal
Antigen
Huntingtin-interacting protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QVIQDALNQLEEPPLISCAGSADHLLSTVTSISSC
IEQLEKSWSQYLACPEDISGLLHSITLLAHLTSDA
IAHGATTCLRAPPEPADSLTEACKQYGRETLAYLA
SLEEEGSLENADSTAMRNCLSKIKAIGEELLPRGL
Storage
-20C
Provider Type Product Number
- No reagents -