Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00064838-B01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00064838-B01, RRID:AB_1017981
- Product name
- FNDC4 MaxPab mouse polyclonal antibody (B01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human FNDC4 protein.
- Antigen sequence
MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLV
SCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVP
EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACAL
WGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKG
SDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVV
VLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGP
EQSPQGRPVGTRQKKSPSINTIDV- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of FNDC4 expression in transfected 293T cell line (H00064838-T01) by FNDC4 MaxPab polyclonal antibody.Lane 1: FNDC4 transfected lysate(25.74 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of purified MaxPab antibody to FNDC4 on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol