Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB20182 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB20182, RRID:AB_10965984
- Product name
- ZNF90 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant ZNF90.
- Antigen sequence
VVTKPDLITCLEQGKKPFTVKRHEMIAKSPVMCFH
FAQDLCPEQSLKDSFQKVIVTRYEKREYGNLELKK
GCESVDEGKVHKRGYNGLNQCLTATQSK- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with ZNF90 polyclonal antibody (Cat # PAB20182).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line U-2 OS with ZNF90 polyclonal antibody (Cat # PAB20182) at 1-4 ug/mL dilution shows positivity in nucleus, golgi apparatus.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human colon with ZNF90 polyclonal antibody (Cat # PAB20182) shows strong cytoplasmic and membranous positivity in glandular cells at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)