HPA003227

ZNF90 antibody from Sigma-Aldrich
HTF9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003227
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003227, RRID:AB_1859471
Product name
Anti-ZNF90 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003227
Antibody type
Polyclonal
Antigen
Zinc finger protein 90 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVTKPDLITCLEQGKKPFTVKRHEMIAKSPVMCFH
FAQDLCPEQSLKDSFQKVIVTRYEKREYGNLELKK
GCESVDEGKVHKRGYNGLNQCLTATQSK
Storage
-20C
Provider Type Product Number
- No reagents -