Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051458-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051458-M06, RRID:AB_606927
- Product name
- RHCG monoclonal antibody (M06), clone 5A4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RHCG.
- Antigen sequence
LPFWGQPSDENCFEDAVYWEMPEGNSTVYIPEDPT
FKPSGPSVPSVPMVSPLPMASSVPLVP- Isotype
- IgG
- Antibody clone number
- 5A4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Remodeling of the fetal collecting duct epithelium.
Hiatt MJ, Ivanova L, Toran N, Tarantal AF, Matsell DG
The American journal of pathology 2010 Feb;176(2):630-7
The American journal of pathology 2010 Feb;176(2):630-7
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RHCG monoclonal antibody (M06), clone 5A4 Western Blot analysis of RHCG expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to RHCG on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol