Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406753 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-gamma-aminobutyric Acid (GABA) A Receptor, gamma 2 (GABRG2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GABRG2 antibody: synthetic peptide directed towards the N terminal of human GABRG2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
GFTSQKSDDDYEDYASNKTWVLTPKVPEGDVTVIL
NNLLE GYDNKLRPDI- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Genetic screening of Scandinavian families with febrile seizures and epilepsy or GEFS+.
Selmer KK, Egeland T, Solaas MH, Nakken KO, Kjeldsen MJ, Friis ML, Brandal K, Corey LA, Undlien DE
Acta neurologica Scandinavica 2008 Apr;117(4):289-92
Acta neurologica Scandinavica 2008 Apr;117(4):289-92
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting