Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405143 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Phospholipase D2 (PLD2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PLD2 antibody: synthetic peptide directed towards the N terminal of human PLD2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Bovine
- Host
- Rabbit
- Antigen sequence
MTATPESLFPTGDELDSSQLQMESDEVDTLKEGED
PADRM HPFLAIYELQ- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Protein kinase C-epsilon regulates sphingosine 1-phosphate-mediated migration of human lung endothelial cells through activation of phospholipase D2, protein kinase C-zeta, and Rac1.
Gorshkova I, He D, Berdyshev E, Usatuyk P, Burns M, Kalari S, Zhao Y, Pendyala S, Garcia JG, Pyne NJ, Brindley DN, Natarajan V
The Journal of biological chemistry 2008 Apr 25;283(17):11794-806
The Journal of biological chemistry 2008 Apr 25;283(17):11794-806
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting