HPA003536

LGALS2 antibody from Sigma-Aldrich
HL14
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003536
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003536, RRID:AB_1078936
Product name
Anti-LGALS2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003536
Antibody type
Polyclonal
Antigen
Galectin-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGT
DKLNLHFNPRFSESTIVCNSLDGSNWGQEQREDHL
CFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRL
GHSHLSYLSVRGGFNMSSFKL
Storage
-20C
Provider Type Product Number
- No reagents -