Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311340 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 340 (ZNF340) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZBTB46 antibody: synthetic peptide directed towards the N terminal of human ZBTB46
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
MNNRKEDMEITSHYRHLLRELNEQRQHGVLCDVCV
VVEGK VFKAHKNVLL- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references NotI flanking sequences: a tool for gene discovery and verification of the human genome.
Kutsenko AS, Gizatullin RZ, Al-Amin AN, Wang F, Kvasha SM, Podowski RM, Matushkin YG, Gyanchandani A, Muravenko OV, Levitsky VG, Kolchanov NA, Protopopov AI, Kashuba VI, Kisselev LL, Wasserman W, Wahlestedt C, Zabarovsky ER
Nucleic acids research 2002 Jul 15;30(14):3163-70
Nucleic acids research 2002 Jul 15;30(14):3163-70
No comments: Submit comment
No validations: Submit validation data