HPA013997

ZBTB46 antibody from Sigma-Aldrich
BTBD4, BZEL, FLJ13502, RINZF, ZNF340
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013997
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013997, RRID:AB_1858961
Product name
Anti-ZBTB46 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013997
Antibody type
Polyclonal
Antigen
Zinc finger and BTB domain-containing protein 46 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QACHDFIKAALDISIKSDASDELAEFEIGASSSSS
TEALISAVMAGRSISPWLARRTSPANSSGDSAIAS
CHDGGSSYGKEDQEPKADGPDDVSSQPLWPGDVGY
GPLRIKEEQVSPSQYGGSELPSAKDGAVQ
Storage
-20C
Provider Type Product Number
- No reagents -