HPA014028

TMEM204 antibody from Sigma-Aldrich
C16orf30, CLP24, FLJ20898
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014028
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014028, RRID:AB_2204906
Product name
Anti-TMEM204 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014028
Antibody type
Polyclonal
Antigen
Transmembrane protein 204 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HKREDCMAPRVIVISRSLTARFRRGLDNDYVESPC
Storage
-20C
Provider Type Product Number
- No reagents -