HPA015639

HSPA12B antibody from Sigma-Aldrich
C20orf60, dJ1009E24.2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015639
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015639, RRID:AB_1851192
Product name
Anti-HSPA12B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015639
Antibody type
Polyclonal
Antigen
Heat shock 70 kDa protein 12B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LAVPEMGLQGLYIGSSPERSPVPSPPGSPRTQESC
GIAPLTPSQSPKPEVRAPQQASFSVVVAIDFGTTS
SGYAFSFASDPEAIHMMRKWEGG
Storage
-20C
Provider Type Product Number
- No reagents -