HPA014030

KANK4 antibody from Sigma-Aldrich
ANKRD38, KIAA0172
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014030
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014030, RRID:AB_2128155
Product name
Anti-KANK4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014030
Antibody type
Polyclonal
Antigen
KN motif and ankyrin repeat domain-containing protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IKAREQRIRELEFTVAQLEGQFHQENAKDTQGQTD
VMVNTDPVHGLLTRESCDKGIEVNLLGSMESESWG
HRGEENGLLWGPDGHKQGNQSPAERVLLPQLSLPQ
GPEQVLTSSVHSFLSTELRIEEAGTEQEGGPQGGT
RGAGGFLWGS
Storage
-20C
Provider Type Product Number
- No reagents -