HPA014030

KANK4 antibody from Atlas Antibodies
ANKRD38, KIAA0172
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014030
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014030, RRID:AB_1236273
Product name
Anti-KANK4
Provider product page
Atlas Antibodies - HPA014030
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IKAREQRIRELEFTVAQLEGQFHQENAKDTQGQTD
VMVNTDPVHGLLTRESCDKGIEVNLLGSMESESWG
HRGEENGLLWGPDGHKQGNQSPAERVLLPQLSLPQ
GPEQVLTSSVHSFLSTELRIEEAGTEQEGGPQGGT
RGAGGFLWGS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -