HPA014030

KANK4 antibody from Atlas Antibodies
ANKRD38, KIAA0172
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014030
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014030, RRID:AB_2128155
Product name
Anti-KANK4
Provider product page
Atlas Antibodies - HPA014030
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IKAREQRIRELEFTVAQLEGQFHQENAKDTQGQTD
VMVNTDPVHGLLTRESCDKGIEVNLLGSMESESWG
HRGEENGLLWGPDGHKQGNQSPAERVLLPQLSLPQ
GPEQVLTSSVHSFLSTELRIEEAGTEQEGGPQGGT
RGAGGFLWGS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -