Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA014030 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA014030, RRID:AB_2128155
- Product name
- Anti-KANK4
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
IKAREQRIRELEFTVAQLEGQFHQENAKDTQGQTD
VMVNTDPVHGLLTRESCDKGIEVNLLGSMESESWG
HRGEENGLLWGPDGHKQGNQSPAERVLLPQLSLPQ
GPEQVLTSSVHSFLSTELRIEEAGTEQEGGPQGGT
RGAGGFLWGS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references KANK deficiency leads to podocyte dysfunction and nephrotic syndrome
Gee H, Zhang F, Ashraf S, Kohl S, Sadowski C, Vega-Warner V, Zhou W, Lovric S, Fang H, Nettleton M, Zhu J, Hoefele J, Weber L, Podracka L, Boor A, Fehrenbach H, Innis J, Washburn J, Levy S, Lifton R, Otto E, Han Z, Hildebrandt F
Journal of Clinical Investigation 2015 June;125(6):2375-2384
Journal of Clinical Investigation 2015 June;125(6):2375-2384
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human placenta tissue.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows moderate to strong cytoplasmic positivity in exocrine glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows weak positivity in myocytes as expected.
- Sample type
- HUMAN