Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00140458-M03 - Provider product page

- Provider
- Abnova Corporation
- Product name
- ASB5 monoclonal antibody (M03), clone 6B10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ASB5.
- Antigen sequence
LLYAGADVQKGKYWDTPLHAAAQQSSTEIVNLLLE
FGADINAKNTELLRPIDVATSSSMVERILLQHEAT
PSSLYQLCRLCIRSYIGKPRLHLIPQLQLPTLLKN
FLQY- Isotype
- IgG
- Antibody clone number
- 6B10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ASB5 expression in transfected 293T cell line by ASB5 monoclonal antibody (M03), clone 6B10.Lane 1: ASB5 transfected lysate (Predicted MW: 36.3 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ASB5 monoclonal antibody (M03), clone 6B10. Western Blot analysis of ASB5 expression in NIH/3T3.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ASB5 is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol