Antibody data

Product number
H00010100-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010100-M05, RRID:AB_1137515
Product name
TSPAN2 monoclonal antibody (M05), clone 1F2
Provider product page
Abnova Corporation - H00010100-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TSPAN2.
Antigen sequence
GKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFH
STFQCCGKESSEQVQPTCPKELLGHKNCIDEIETI
ISVKLQ
Isotype
IgG
Antibody clone number
1F2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -