HPA015640

TSPAN2 antibody from Sigma-Aldrich
FLJ12082, TSN2, TSPAN-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015640
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015640, RRID:AB_1858405
Product name
Anti-TSPAN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015640
Antibody type
Polyclonal
Antigen
Tetraspanin-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTF
QCCGKESSEQVQPTCPKELLGHKNCIDEIETIISV
KLQ
Storage
-20C
Provider Type Product Number
- No reagents -