Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055897-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055897-M06, RRID:AB_875709
- Product name
- MESP1 monoclonal antibody (M06), clone 1F9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MESP1.
- Antigen sequence
MAQPLCPPLSESWMLSAAWGPTRRPPPSDKDCGRS
LVSSPDSWGSTPADSPVASPARPGTLRD- Isotype
- IgG
- Antibody clone number
- 1F9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MESP1 monoclonal antibody (M06), clone 1F9. Western Blot analysis of MESP1 expression in FHs 173 WE.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MESP1 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol