Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 101-M90 - Provider product page
- Provider
- ReliaTech GmbH
- Product name
- VEGF-C
- Antibody type
- Monoclonal
- Antigen
- Recombinant human VEGF-C
- Description
- antibody purified from hybridoma supernatant
- Reactivity
- Human, Rat
- Host
- Mouse
- Antigen sequence
DPTEETIKFAAAHYNTEILKSIDNEWRKTQCMPRE
VCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEG
LQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFAN
HTSCRCMSKLHHHHHH- Isotype
- IgG
- Antibody clone number
- (#9E7)
- Vial size
- 100 µl
- Storage
- Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
- Handling
- Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Staining of VEGF-C on cryo sections (acetone-fixed) of rat mammary tumors.
- Sample type
- Rat mammary tumors
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Staining of VEGF-C on cryo sections (unfixed) of rat mammary tumors.
- Sample type
- Rat mammary tumors
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- IHC with paraffin-embedded sections of human colon carcninoma tissue. Wroclaw Medical University Departmetnt of Histology and Embriology
- Sample type
- Human colon carcinoma tissue