Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 101-M88 - Provider product page
- Provider
- ReliaTech GmbH
- Product name
- VEGF-C
- Antibody type
- Monoclonal
- Antigen
- Recombinant human VEGF-C
- Description
- antibody purified from hybridoma supernatant
- Reactivity
- Human, Rat
- Host
- Mouse
- Antigen sequence
DPTEETIKFAAAHYNTEILKSIDNEWRKTQCMPRE
VCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEG
LQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFAN
HTSCRCMSKLHHHHHH- Isotype
- IgG
- Antibody clone number
- (#9G10)
- Vial size
- 100 µl
- Storage
- Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
- Handling
- Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Western analysis of recombinant rat VEGF-C [RT# R20-015) derived from insect cells using a monoclonal antibody directed against recombinant human/rat VEGF-C. The antibody do not recognize the unreduced form. The bands correspond to different glycosylated forms.
- Sample type
- Purified recombinant proteins
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Western analysis of recombinant human VEGF-C [RT# 300-078) derived from insect cells using a monoclonal antibody directed against recombinant human/rat VEGF-C. The antibody do not recognize the unreduced form. The bands correspond to different glycosylated forms.
- Sample type
- Purified recombinant proteins
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- VEGF-C Sandwich-ELISA using recombinant human VEGF-C as standard [Cat# 300-079]. Mouse anti-human VEGF-C #9/G10 (Cat# 101-M88) was used as capture antibody, Biotinylated mouse anti-human VEGF-C #107/A11 (Cat# 101-MBi89) was used for detection.
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- VEGF-C Sandwich-ELISA using recombinant rat VEGF-C as standard [Cat# R20-014]. Mouse anti-human VEGF-C #9/G10 (Cat# 101-M88) was used as capture antibody, Biotinylated rabbit anti-rat VEGF-C (Cat# 104-PABi10) was used for detection.