Antibody data

Product number
101-M88
Provider
ReliaTech GmbH
Product name
VEGF-C
Provider product page
ReliaTech GmbH - 101-M88
Antibody type
Monoclonal
Antigen
Recombinant human VEGF-C
Description
antibody purified from hybridoma supernatant
Reactivity
Human, Rat
Host
Mouse
Antigen sequence
DPTEETIKFAAAHYNTEILKSIDNEWRKTQCMPRE
VCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEG
LQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFAN
HTSCRCMSKLHHHHHH
Isotype
IgG
Antibody clone number
(#9G10)
Vial size
100 µl
Storage
Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
Handling
Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
Provider Type Product Number
- No reagents -