Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00026580-A02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00026580-A02, RRID:AB_627320
- Product name
- BSCL2 polyclonal antibody (A02)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant BSCL2.
- Antigen sequence
WPRHRFSLQVNIRKRDNSRKEVQRRISAHQPGPEG
QEESTPQSDVTEDGESPEDPSGTEGQLSEEEKPDQ
QPLSGEEELEPEASDGSGSWED- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Adipose-specific knockout of SEIPIN/BSCL2 results in progressive lipodystrophy.
Overexpression of a short human seipin/BSCL2 isoform in mouse adipose tissue results in mild lipodystrophy.
Liu L, Jiang Q, Wang X, Zhang Y, Lin RC, Lam SM, Shui G, Zhou L, Li P, Wang Y, Cui X, Gao M, Zhang L, Lv Y, Xu G, Liu G, Zhao D, Yang H
Diabetes 2014 Jul;63(7):2320-31
Diabetes 2014 Jul;63(7):2320-31
Overexpression of a short human seipin/BSCL2 isoform in mouse adipose tissue results in mild lipodystrophy.
Cui X, Wang Y, Meng L, Fei W, Deng J, Xu G, Peng X, Ju S, Zhang L, Liu G, Zhao L, Yang H
American journal of physiology. Endocrinology and metabolism 2012 Mar 15;302(6):E705-13
American journal of physiology. Endocrinology and metabolism 2012 Mar 15;302(6):E705-13
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of BSCL2 expression in transfected 293T cell line by BSCL2 polyclonal antibody (A02).Lane1:BSCL2 transfected lysate (Predicted MW: 44.5 KDa).Lane2:Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- BSCL2 polyclonal antibody (A02). Western Blot analysis of BSCL2 expression in Jurkat.