SAB1401633

BSCL2 antibody from Sigma-Aldrich
GNG3LG, SPG17
No application information provided.

Antibody data

Product number
SAB1401633
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1401633, RRID:AB_10607869
Product name
Anti-BSCL2 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1401633
Antibody type
Polyclonal
Antigen
BSCL2 (AAH09866.2, 1 a.a. ~ 400 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MVNDPPVPALLWAQEVGQVLAGRARRLLLQFGVLF
CTILLLLWVSVFLYGSFYYSYMPTVSHLSPVHFYY
RTDCDSSTTSLCSFPVANVSLTKGGRDRVLMYGQP
YRVTLELELPESPVNQDLGMFLVTISCYTRGGRII
STSSRSVMLHYRSDLLQMLDTLVFSSLLLFGFAEQ
KQLLEVELYADYRENSYVPTTGAIIEIHSKRIQLY
GAYLRIHAHFTGLRYLLYNFPMTCAFIGVASNFTF
LSVIVLFSYM
Storage
-20C
Provider Type Product Number
- No reagents -