HPA012093

TMBIM1 antibody from Sigma-Aldrich
LFG3, PP1201, RECS1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012093
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012093, RRID:AB_1858056
Product name
Anti-TMBIM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012093
Antibody type
Polyclonal
Antigen
Transmembrane BAX inhibitor motif-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GYGQPSVLPGGYPAYPGYPQPGYGHPAGYPQPMPP
THPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKV
RHT
Storage
-20C
Provider Type Product Number
- No reagents -