HPA024812

C8orf33 antibody from Sigma-Aldrich
FLJ20989
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024812
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024812, RRID:AB_10599490
Product name
Anti-C8orf33 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024812
Antibody type
Polyclonal
Antigen
UPF0488 protein C8orf33 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LMHSLFGDYRAQMEAEWREALRALRAAAYSAQVQP
VDGATRKKSQRVCRPRSIWRAKATLD
Storage
-20C
Provider Type Product Number
- No reagents -