HPA026104

C8orf33 antibody from Sigma-Aldrich
FLJ20989
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026104
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026104, RRID:AB_10600875
Product name
Anti-C8orf33 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026104
Antibody type
Polyclonal
Antigen
UPF0488 protein C8orf33 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RNRASVANGGEKASEKLAPEEVPLSAEAQAQQLAQ
ELAWCVEQLELGLKRQKPTPKQKEQAIGAIRTLRS
K
Storage
-20C
Provider Type Product Number
- No reagents -