PAB20142

SRRD antibody from Abnova Corporation
HC/HCC, SRR1L

Antibody data

Product number
PAB20142
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20142, RRID:AB_10963987
Product name
SRRD polyclonal antibody
Provider product page
Abnova Corporation - PAB20142
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant SRRD.
Antigen sequence
AEKDLFISDFWSSALETINRCLTKHLEQLKAPVGT
LSDIFGNLHLDSLPEESDVATDSIPREILVTGTCH
LKCVCYGIGNFATCIVARNQLTFLLLLLEKCQIPR
SHCWVYDPLFSQLEIEVLNTLGVTVLSENEEGKRS
I
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.