HPA002945

SRRD antibody from Atlas Antibodies
HC/HCC, SRR1L
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002945
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002945, RRID:AB_612008
Product name
Anti-SRRD
Provider product page
Atlas Antibodies - HPA002945
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AEKDLFISDFWSSALETINRCLTKHLEQLKAPVGT
LSDIFGNLHLDSLPEESDVATDSIPREILVTGTCH
LKCVCYGIGNFATCIVARNQLTFLLLLLEKCQIPR
SHCWVYDPLFSQLEIEVLNTLGVTVLSENEEGKRS
I
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -