ABIN405957

SRRD antibody from antibodies-online
HC/HCC, SRR1L
Western blot
Data presented on provider website

Antibody data

Product number
ABIN405957
Provider
antibodies-online
Product name
anti-SRR1 Domain Containing (SRRD) (Middle Region) antibody
Provider product page
antibodies-online - ABIN405957
Antibody type
Polyclonal
Antigen
The immunogen for anti-SRRD antibody: synthetic peptide directed towards the middle region of human SRRD
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
DIFNDTSVHWFPVQKLEQLSIDIWEFREEPDYQDC
EDLEI IRNKREDPSA
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.