HPA002945

SRRD antibody from Sigma-Aldrich
HC/HCC, SRR1L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002945
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002945, RRID:AB_1079265
Product name
Anti-SRR1L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002945
Antibody type
Polyclonal
Antigen
SRR1-like protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AEKDLFISDFWSSALETINRCLTKHLEQLKAPVGT
LSDIFGNLHLDSLPEESDVATDSIPREILVTGTCH
LKCVCYGIGNFATCIVARNQLTFLLLLLEKCQIPR
SHCWVYDPLFSQLEIEVLNTLGVTVLSENEEGKRS
I
Storage
-20C
Provider Type Product Number
- No reagents -