SAB2102303

SRRD antibody from MilliporeSigma / Merck KGaA
HC/HCC, SRR1L
No application information provided.

Antibody data

Product number
SAB2102303
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-SRRD antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2102303
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_001013716.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DIFNDTSVHWFPVQKLEQLSIDIWEFREEPDYQDC
EDLEIIRNKREDPSA
Storage
-20C