LS-B13259

antibody from LSBio

Targeting: MSRB3 DFNB74, DKFZp686C1178, FLJ36866

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: LS-B13259 - Provider product page
Provider: LSBio
Product name: Anti-MSRB3 Antibody IHC-plus™ LS-B13259
Antibody type: Polyclonal
Antigen: Synthetic peptide directed towards the following sequence ESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEA
Description: Immunoaffinity purified
Reactivity: Human, Mouse, Rat, Bovine, Guinea Pig, Horse, Rabbit
Host: Rabbit
Vial size: 50µg
Storage: Short term +4°C (no longer than one week); Long term -20°C; Aliquot to avoid freeze/thaw cycles.

MSRB3 protein structure - LS-B13259 shown in red.