HPA014432

MSRB3 antibody from Sigma-Aldrich
DFNB74, DKFZp686C1178, FLJ36866
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014432
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014432, RRID:AB_1854146
Product name
Anti-MSRB3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014432
Antibody type
Polyclonal
Antigen
Methionine-R-sulfoxide reductase B3, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTP
LFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYG
MHRVETSCSQCGAHLGHIFDDGPRPTGKRYC
Storage
-20C
Provider Type Product Number
- No reagents -