HPA053280

PSMB9 antibody from Atlas Antibodies
beta1i, LMP2, PSMB6i, RING12
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA053280
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA053280, RRID:AB_2682098
Product name
Anti-PSMB9
Provider product page
Atlas Antibodies - HPA053280
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCAL
SGS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -