H00005698-A01

PSMB9 antibody from Abnova Corporation
beta1i, LMP2, PSMB6i, RING12
No application information provided.

Antibody data

Product number
H00005698-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005698-A01, RRID:AB_606861
Product name
PSMB9 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00005698-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length recombinant PSMB9.
Antigen sequence
MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMG
SDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAA
DAQAVADMAAYQLELHGIELEEPPLVLAAANVVRN
ISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLT
RQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFT
TDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILG
NELPKFYDE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -