HPA042818

PSMB9 antibody from Atlas Antibodies
beta1i, LMP2, PSMB6i, RING12

Antibody data

Product number
HPA042818
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA042818, RRID:AB_2678186
Product name
Anti-PSMB9
Provider product page
Atlas Antibodies - HPA042818
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GIELEEPPLVLAAANVVRNISYKYREDLSAHLMVA
GWDQREGG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -