HPA014092

ACER2 antibody from Sigma-Aldrich
ASAH3L, FLJ41587
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014092
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014092, RRID:AB_2223317
Product name
Anti-ACER2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014092
Antibody type
Polyclonal
Antigen
Alkaline ceramidase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DAASEIPEQGPVIKFWPNEKWAFIGVPYVSLLCAN
KKSSVKIT
Storage
-20C
Provider Type Product Number
- No reagents -