Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA014092 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-ACER2
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DAASEIPEQGPVIKFWPNEKWAFIGVPYVSLLCAN
KKSSVKIT- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Activity of neutral and alkaline ceramidases on fluorogenic N-acylated coumarin-containing aminodiols
Casasampere M, Camacho L, Cingolani F, Casas J, Egido-Gabás M, Abad J, Bedia C, Xu R, Wang K, Canals D, Hannun Y, Mao C, Fabrias G
Journal of Lipid Research 2015;56(10):2019-2028
Journal of Lipid Research 2015;56(10):2019-2028
No comments: Submit comment
No validations: Submit validation data