WH0064746M1

ACBD3 antibody from Sigma-Aldrich
GCP60, GOCAP1, GOLPH1, PAP7
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0064746M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0064746M1, RRID:AB_2220068
Product name
Monoclonal Anti-ACBD3 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0064746M1
Antibody type
Monoclonal
Antigen
ACBD3 (NP_073572, a.a. 73-172) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human, Mouse, Rat
Antigen sequence
RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYE
EKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDR
RREWAALGNMSKEDAMVEFVKLLNRCCHL* (wit
hout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -