Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00064746-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00064746-M01, RRID:AB_565443
- Product name
- ACBD3 monoclonal antibody (M01), clone 2G2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ACBD3.
- Antigen sequence
RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYE
EKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDR
RREWAALGNMSKEDAMVEFVKLLNRCCHL- Isotype
- IgG
- Antibody clone number
- 2G2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Searching for cellular partners of hantaviral nonstructural protein NSs: Y2H screening of mouse cDNA library and analysis of cellular interactome.
Rönnberg T, Jääskeläinen K, Blot G, Parviainen V, Vaheri A, Renkonen R, Bouloy M, Plyusnin A
PloS one 2012;7(4):e34307
PloS one 2012;7(4):e34307
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ACBD3 expression in transfected 293T cell line by ACBD3 monoclonal antibody (M01), clone 2G2.Lane 1: ACBD3 transfected lysate(60.6 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ACBD3 monoclonal antibody (M01), clone 2G2. Western Blot analysis of ACBD3 expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ACBD3 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ACBD3 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ACBD3 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol