H00064746-M02

ACBD3 antibody from Abnova Corporation
GCP60, GOCAP1, GOLPH1, PAP7

Antibody data

Product number
H00064746-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00064746-M02, RRID:AB_1112606
Product name
ACBD3 monoclonal antibody (M02), clone 2H2
Provider product page
Abnova Corporation - H00064746-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ACBD3.
Antigen sequence
RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYE
EKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDR
RREWAALGNMSKEDAMVEFVKLLNRCCHL
Isotype
IgG
Antibody clone number
2H2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -