Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00064746-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00064746-M02, RRID:AB_1112606
- Product name
- ACBD3 monoclonal antibody (M02), clone 2H2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ACBD3.
- Antigen sequence
RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYE
EKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDR
RREWAALGNMSKEDAMVEFVKLLNRCCHL- Isotype
- IgG
- Antibody clone number
- 2H2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Eukaryotic protein recruitment into the Chlamydia inclusion: implications for survival and growth.
Soupene E, Rothschild J, Kuypers FA, Dean D
PloS one 2012;7(5):e36843
PloS one 2012;7(5):e36843
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ACBD3 monoclonal antibody (M02), clone 2H2. Western Blot analysis of ACBD3 expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ACBD3 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol