HPA015594

ACBD3 antibody from Sigma-Aldrich
GCP60, GOCAP1, GOLPH1, PAP7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015594
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015594, RRID:AB_1844491
Product name
Anti-ACBD3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015594
Antibody type
Polyclonal
Antigen
Golgi resident protein GCP60 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQ
QQAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSV
NGQAKTHTDSSEKELEPEAAEEALENGPKESLPVI
AAPSMWTRPQIKDFKEKIQQDADSVIT
Storage
-20C
Provider Type Product Number
- No reagents -