HPA005685

ARMCX1 antibody from Sigma-Aldrich
ALEX1, GASP7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005685
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005685, RRID:AB_10600781
Product name
Anti-ARMCX1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005685
Antibody type
Polyclonal
Antigen
armadillo repeat containing, X-linked 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DEESTDTSEIGVETVKGAKTNAGAGSGAKLQGDSE
VKPEVSLGLEDCPGVKEKAHSGSHSGGGLEAKAKA
LFNTLKEQASAKAGKGARVGTISGNRTLAPSLPCP
Storage
-20C
Provider Type Product Number
- No reagents -