HPA017671

GPC6 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017671
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017671, RRID:AB_1849833
Product name
Anti-GPC6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017671
Antibody type
Polyclonal
Antigen
Glypican-6 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KGFSLADIPYQEIAGEHLRICPQEYTCCTTEMEDK
LSQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFF
RELLENAEK
Storage
-20C
Provider Type Product Number
- No reagents -