Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109545 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Zinc Finger and BTB Domain Containing 7C (ZBTB7C) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZBTB7C antibody: synthetic peptide directed towards the N terminal of human ZBTB7C
- Description
- Purified using Protein A affinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
MANDIDELIGIPFPNHSSEVLCSLNEQRHDGLLCD
VLLVVQEQEYRTHRS- Epitope
- N-Term
- Vial size
- 0.1 mg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Characterization of a novel human papillomavirus DNA in the cervical carcinoma cell line ME180.
Reuter S, Delius H, Kahn T, Hofmann B, zur Hausen H, Schwarz E
Journal of virology 1991 Oct;65(10):5564-8
Journal of virology 1991 Oct;65(10):5564-8
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Raji; WB Suggested Anti-ZBTB7C Antibody Titration: 5.0ug/ml. Positive Control: Raji cell lysate. ZBTB7C is supported by BioGPS gene expression data to be expressed in Raji.; ZBTB7C antibody - N-terminal region (AP42149PU-N) in Human Raji cells using Western Blot